AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-GPT antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-GPT 폴리클로날 항체로, rat, mouse, human에 반응합니다. Prestige Antibodies® 제품군으로 고품질 검증을 거쳤으며, immunoblotting 및 immunohistochemistry에 적합합니다. -20°C에서 보관하며 wet ice로 배송됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-GPT antibody produced in rabbit
Anti-GPT antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, ab1
생물학적 소스
rabbit
품질 등급
100
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
rat, mouse, human
포장
antibody small pack of 25 μL
향상된 검증
- orthogonal RNAseq
- independent
자세한 내용은 Antibody Enhanced Validation 문서를 참고하세요.
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunohistochemistry: 1:500–1:1000
면역원 서열
MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
Human GPT(2875)
The GPT (Glutamate pyruvate transaminase 1) gene is mapped to human chromosome 8q24.3.
The gene consists of 11 exons and encodes a protein of 495 amino acids, identical to human GPT-1.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Antibody Type | Polyclonal, Primary |
| Conjugation | Unconjugated |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Rat, Mouse, Human |
| Validation | Orthogonal RNAseq, Independent |
| Techniques | Immunoblotting (0.04–0.4 μg/mL), Immunohistochemistry (1:500–1:1000) |
| Packaging | 25 μL small pack |
| Storage Temperature | −20°C |
| Shipment | Wet ice |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.