Merck Anti-GPT antibody produced in rabbit

Anti-GPT antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution, ab1

---

생물학적 소스

rabbit

품질 등급

100

결합 형태

unconjugated

항체 형태

affinity isolated antibody

항체 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

제형

buffered aqueous glycerol solution

반응 종

rat, mouse, human

포장

antibody small pack of 25 μL

향상된 검증

• orthogonal RNAseq
• independent
  자세한 내용은 Antibody Enhanced Validation 문서를 참고하세요.

적용 기술

• Immunoblotting: 0.04–0.4 μg/mL
• Immunohistochemistry: 1:500–1:1000

면역원 서열

MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT

UniProt 수납 번호

P24298

배송 상태

wet ice

저장 온도

−20°C

---

Gene Information

Human GPT(2875)

The GPT (Glutamate pyruvate transaminase 1) gene is mapped to human chromosome 8q24.3.
The gene consists of 11 exons and encodes a protein of 495 amino acids, identical to human GPT-1.

---

제품 스펙 요약

항목	내용
Biological Source	Rabbit
Antibody Type	Polyclonal, Primary
Conjugation	Unconjugated
Form	Buffered aqueous glycerol solution
Species Reactivity	Rat, Mouse, Human
Validation	Orthogonal RNAseq, Independent
Techniques	Immunoblotting (0.04–0.4 μg/mL), Immunohistochemistry (1:500–1:1000)
Packaging	25 μL small pack
Storage Temperature	−20°C
Shipment	Wet ice
Product Line	Prestige Antibodies® Powered by Atlas Antibodies