AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-PBLD antibody produced in rabbit
상품 한눈에 보기
토끼 유래 polyclonal Anti-PBLD 항체로, 인간 PBLD 단백질을 특이적으로 인식합니다. Prestige Antibodies® 제품으로 높은 품질 보증과 향상된 검증(orthogonal RNAseq, independent validation)을 거쳤습니다. Western blot, IHC 등 다양한 연구에 적합합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-PBLD antibody produced in rabbit
Anti-PBLD antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody product type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 (Enhanced Validation) | Orthogonal RNAseq, Independent validation |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 (Immunogen sequence) | LSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTE |
| UniProt 수납 번호 | P30039 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
| Gene Information | Human PBLD(64081) |
제품 설명
Phenazine biosynthesis like protein domain containing (PBLD), also known as mitogen-activated protein kinase activator with WD40 repeats binding protein (MAWBP), is the only member of the phenazine biosynthesis-like protein family.
The encoded protein is widely expressed in various human tissues including brain, heart, lung, liver, pancreas, kidney, and placenta.
참고 링크
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.