
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-ERLEC1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-ERLEC1 다클론 항체로, 인간 ERLEC1 단백질에 특이적입니다. Prestige Antibodies® 라인 제품으로, 면역블롯 및 면역조직화학에 적합합니다. 친화 정제된 항체이며, −20°C에서 보관합니다.
- 카탈로그번호
- HPA031503-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA031503-100UL Anti-ERLEC1 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-ERLEC1 antibody produced in rabbit
Anti-ERLEC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
품질 등급
100
결합
unconjugated
항체 형태
affinity isolated antibody
항체 종류
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
반응 종
human
향상된 검증
- recombinant expression
- independent
자세한 내용은 Antibody Enhanced Validation 참고
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
SDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ERLEC1(27248)
Endoplasmic reticulum lectin 1 (ERLEC1), also called Erlectin (XTP3-B), belongs to the mannose 6-phosphate receptor homology (MRH) domain family. It has a signal peptide and two MRH domains. The ERLEC1 gene is mapped to human chromosome 2p16.2.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Antibody Type | Primary, Polyclonal |
| Product Line | Prestige Antibodies® |
| Formulation | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Validation | Recombinant expression, Independent |
| Techniques | Immunoblotting, Immunohistochemistry |
| Immunogen Sequence | SDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKH |
| UniProt Accession | Q96DZ1 |
| Shipping | Wet ice |
| Storage Temperature | −20°C |
| Gene | ERLEC1 (Human) |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



