CacheBy
Merck Anti-FKBP11 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-FKBP11 antibody produced in rabbit

상품 한눈에 보기

Rabbit에서 생산된 Anti-FKBP11 항체로, human 및 mouse 시료에 반응합니다. Prestige Antibodies® 시리즈로 고품질 polyclonal 항체입니다. 면역형광, 면역조직화학, 웨스턴블롯 등 다양한 기법에 적합합니다. −20°C에서 보관하며, wet ice 상태로 배송됩니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-FKBP11 antibody produced in rabbit

Anti-FKBP11 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution


제품 정보

항목 내용
Biological source Rabbit
Quality level 100
Conjugate Unconjugated
Antibody form Affinity isolated antibody
Antibody type Primary antibodies
Clone Polyclonal
Product line Prestige Antibodies® Powered by Atlas Antibodies
Form Buffered aqueous glycerol solution
Species reactivity Human, Mouse
Packaging Antibody small pack of 25 μL
Validated by Orthogonal RNAseq
Shipping conditions Wet ice
Storage temperature −20 °C
UniProt accession no. Q9NYL4
Gene information Human FKBP11 (51303)

  • Immunoblotting (WB): 0.04–0.4 μg/mL
  • Immunofluorescence (IF): 0.25–2 μg/mL
  • Immunohistochemistry (IHC): 1:500–1:1000

Learn more about Antibody Enhanced Validation (AEV): Antibody performance verified using orthogonal RNAseq data.


Immunogen sequence

EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG

Gene and protein information

FK506 binding protein 11 (FKBP11), 19 kDa recombinant protein epitope signature tag (PrEST)

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.