Merck Anti-RIIAD1 antibody produced in rabbit
Merck의 Anti-RIIAD1 토끼 유래 항체로 인간 RIIAD1 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품이며, 면역조직화학(IHC)에 적합합니다. Affinity purified 형태로 −20°C에서 보관하며, orthogonal RNAseq으로 검증되었습니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-RIIAD1 antibody produced in rabbit
Anti-RIIAD1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
Unconjugated
항체 형태
Affinity isolated antibody
항체 유형
Primary antibodies
클론
Polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
Buffered aqueous glycerol solution
반응 종
Human
포장
Antibody small pack of 25 μL
향상된 검증
Orthogonal RNAseq
자세한 내용은 Antibody Enhanced Validation 참고
적용 기술
Immunohistochemistry: 1:1000–1:2500
면역원 서열
METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH
UniProt 수납 번호
배송 상태
Wet ice
저장 온도
−20°C
유전자 정보
Human RIIAD1 (284485)
Regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1 recombinant protein epitope signature tag (PrEST)
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated |
| Type | Primary, Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Package Size | 25 μL |
| Application | Immunohistochemistry (1:1000–1:2500) |
| Validation | Orthogonal RNAseq |
| Storage | −20°C |
| Shipping | Wet ice |
| UniProt | A6NNX1 |
| Gene | RIIAD1 (284485) |
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.