
Merck Anti-LVRN antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-LVRN polyclonal antibody로 인체 LVRN 단백질 검출에 적합. Prestige Antibodies® 라인으로 높은 품질 보증. 면역조직화학(IHC)에 사용 가능하며 −20°C에서 보관. Buffered glycerol 용액 형태로 제공.
브랜드: Merck Sigma
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LVRN antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 정보
Laeverin (LVRN), also called aminopeptidase Q, is a 120 kDa protein belonging to the M1 family of aminopeptidases.
It is a type II integral membrane protein with HEXXHX18E gluzincin motif and is specifically expressed in extravillous trophoblast of placenta.
The LVRN gene is localized on human chromosome 5q23.1.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Antibody Type | Primary antibody |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Small pack of 25 μL |
| Validation | Orthogonal RNAseq |
| Technique(s) | Immunohistochemistry: 1:2500–1:5000 |
| Immunogen Sequence | IPYPIKDVVLCYGIALGSDKEWDILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTSPFTSNETNIIEVVASSEVGRYVA |
| UniProt Accession | Q6Q4G3 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
| Gene Information | Human LVRN (206338) |
향상된 검증
Orthogonal RNAseq
자세한 내용은 Antibody Enhanced Validation 참고
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




