CacheBy
Merck Anti-EPOP antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-EPOP antibody produced in rabbit

상품 한눈에 보기

Rabbit에서 생산된 Anti-EPOP 항체로, 인간 EPOP(C17orf96) 단백질을 인식하는 polyclonal primary antibody입니다. Prestige Antibodies® Powered by Atlas Antibodies 제품으로, immunofluorescence 및 immunohistochemistry에 적합하며 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-EPOP antibody produced in rabbit

Anti-EPOP antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 affinity isolated 항체로, buffered aqueous glycerol solution 형태로 제공됩니다. 인간 EPOP 단백질(C17orf96)을 인식하며, 다양한 면역 분석 기술에 활용할 수 있습니다.

생물학적 정보

EPOP (elongin BC and polycomb repressive complex 2) 은 C17orf96, esPRC2p48, E130012A19Rik로도 알려져 있으며, 인간 염색체 17q12에 위치합니다.

제품 사양

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibody
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human
포장 Small pack, 25 μL
향상된 검증 Orthogonal RNAseq (Antibody Enhanced Validation)
기술(Techniques) Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:500–1:1000
면역원 서열 NCFPCPPALVVGEDGDLKPASSLRLQGDSK
배송 상태 Wet ice
저장 온도 −20°C
Gene Information Human C17orf96 (100170841)

참고 정보

Learn more about Antibody Enhanced Validation on the supplier’s website.

제품 이미지

(해당 제품 이미지가 있을 경우 이 섹션에 배치)

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.