
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-FMC1 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-FMC1 항체는 토끼에서 생산된 polyclonal 항체로, 인간 시료에 반응하며 immunoblotting, immunofluorescence, immunohistochemistry에 사용됩니다. Prestige Antibodies® 제품군으로 −20°C에서 보관하며, orthogonal RNAseq 검증을 거친 고품질 연구용 항체입니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-FMC1 antibody produced in rabbit
Anti-FMC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
100
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
species reactivity
human
포장
small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
ELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human C7orf55 (154791)
Formation of mitochondrial complex V assembly factor 1 homolog recombinant protein epitope signature tag (PrEST)
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Conjugation | Unconjugated |
| Antibody type | Primary, Polyclonal |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Pack size | 25 μL |
| Validation | Orthogonal RNAseq |
| Techniques | Immunoblotting, Immunofluorescence, Immunohistochemistry |
| Shipping condition | Wet ice |
| Storage temperature | −20°C |
| Gene target | C7orf55 (Human) |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



