Merck Anti-MLC1 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-MLC1 항체로, 인간 MLC1 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 높은 품질과 신뢰성을 제공합니다. Western blot 및 IHC에 적합하며, 정제된 glycerol 완충 용액 형태로 공급됩니다.

브랜드: Merck Sigma
카테고리: Polyclonal Antibodies

#Merck #Sigma #Merck Sigma

Merck Sigma · Merck Anti-MLC1 antibody produced in rabbit

Anti-MLC1 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies의 항체로, 토끼에서 생산된 affinity isolated primary antibody입니다. Buffered aqueous glycerol solution 형태로 제공됩니다.

제품 정보

항목	내용
Biological source	Rabbit
Quality level	100
Conjugate	Unconjugated
Antibody form	Affinity isolated antibody
Antibody type	Primary antibody
Clone	Polyclonal
Product line	Prestige Antibodies® Powered by Atlas Antibodies
Form	Buffered aqueous glycerol solution
Species reactivity	Human
Packaging	Small pack of 25 μL
Enhanced validation	Orthogonal RNAseq, Recombinant expression
Techniques	Immunoblotting: 0.04–0.4 μg/mL; Immunohistochemistry: 1:200–1:500
Immunogen sequence	NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI
UniProt accession no.	Q15049
Shipping conditions	Wet ice
Storage temperature	−20 °C
Gene information	Human MLC1(23209)
Associated disease	Megalencephalic leukoencephalopathy with subcortical cysts 1