
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-SRC antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-SRC 항체로 인간 SRC 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 정제된 1차 폴리클로날 항체입니다. 면역형광, 면역블롯, 면역조직화학에 적합하며 −20°C에서 보관합니다.
- 카탈로그번호
- HPA030875-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA030875-100UL Anti-SRC antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
816,000원VAT 포함 897,600원
Merck Sigma · Merck Anti-SRC antibody produced in rabbit
Anti-SRC antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody product type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Orthogonal RNAseq (Antibody Enhanced Validation) |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS |
| UniProt 번호 | P12931 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
Gene Information
Gene: SRC (6714)
The SRC (sarcoma) gene is located on human chromosome 20q11.23. It is highly expressed in the brain and platelets and belongs to the Src family of tyrosine kinases. These kinases contain a unique myristylated N-terminal domain, followed by SH3, SH2, and tyrosine kinase domains, and a short C-terminal tail.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



