
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-PPP1R10 antibody produced in rabbit
상품 한눈에 보기
Rabbit polyclonal anti-PPP1R10 antibody for human detection. Affinity-isolated, unconjugated, and supplied in buffered glycerol solution. Validated for immunoblotting, immunofluorescence, and immunohistochemistry. Stored at −20°C and shipped on wet ice.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-PPP1R10 antibody produced in rabbit
Anti-PPP1R10 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated, buffered aqueous glycerol solution
생물학적 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 클론 | Polyclonal |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Independent (Antibody Enhanced Validation) |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
사용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
TAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDAL
UniProt 수납 번호
유전자 정보
Human PPP1R10 (Gene ID: 5514)
Protein phosphatase 1, regulatory subunit 10
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



