AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-CYB5A antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-CYB5A rabbit polyclonal antibody로 인간 CYB5A 단백질 검출에 적합. Prestige Antibodies® 라인 제품으로 높은 특이성과 신뢰성 제공. Immunoblotting, IF, IHC 등 다양한 분석에 활용 가능. −20°C에서 안정적으로 보관.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-CYB5A antibody produced in rabbit
Anti-CYB5A antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated primary antibody, buffered aqueous glycerol solution.
생물학적 정보
- Source: Rabbit
- Clone: Polyclonal
- Isotype: IgG
- Species Reactivity: Human
- Gene Symbol: CYB5A
- UniProt Accession Number: P00167
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
항체 특성
- Conjugation: Unconjugated
- Form: Buffered aqueous glycerol solution
- Antibody Type: Primary antibody
- Quality Level: 100
향상된 검증
Orthogonal RNAseq
자세한 내용은 Antibody Enhanced Validation 참고.
적용 기술 및 권장 사용 농도
| Technique | Recommended Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:50–1:200 |
면역원 서열
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG유전자 정보
Cytochrome b5 (CYB5A) gene codes for cytochrome b5 protein.
It is located on human chromosome 18 and is co-expressed in the Leydig cells of the testis and theca cells of the ovary.
보관 및 배송
| Condition | Description |
|---|---|
| Shipping | Wet ice |
| Storage Temperature | −20°C |
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.