
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-ALOXE3
상품 한눈에 보기
Merck Anti-ALOXE3는 인간 ALOXE3 단백질을 인식하는 rabbit polyclonal 1차 항체로, Prestige Antibodies® 라인 제품입니다. Immunohistochemistry(1:200–1:500)에 적합하며, orthogonal RNAseq으로 향상된 검증을 거쳤습니다. −20°C에서 보관하며 25 μL 포장으로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-ALOXE3
Anti-ALOXE3
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody
Recombinant protein corresponding to arachidonate lipoxygenase 3.
생물학적 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Antibody Type | Primary antibodies |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Technique(s) | Immunohistochemistry: 1:200–1:500 |
| UniProt Accession | Q9BYJ1 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
향상된 검증
Orthogonal RNAseq
자세한 내용은 Antibody Enhanced Validation 페이지를 참조하세요.
Gene Information
Human gene: ALOXE3 (59344)
Sequence
YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



