
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-MAGEB2
상품 한눈에 보기
Merck Sigma의 Anti-MAGEB2는 rabbit 소스의 polyclonal primary antibody로, 인간 MAGEB2 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, immunohistochemistry에 적합하고 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-MAGEB2
Anti-MAGEB2
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies의 affinity isolated polyclonal antibody로, 인간 MAGEB2 단백질을 인식합니다.
생물학적 정보
Recombinant protein corresponding to MAGE family member B2
Sequence:
EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
스펙 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Product Type | Primary antibodies |
| Clone Type | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Enhanced Validation | Orthogonal RNAseq, Independent |
| Application Technique(s) | Immunohistochemistry (1:1000–1:2500) |
| UniProt Accession | O15479 |
| Gene Information | Human MAGEB2 (4113) |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
향상된 검증
이 항체는 orthogonal RNAseq 및 independent validation을 통해 검증되었습니다.
자세한 내용은 Antibody Enhanced Validation을 참고하십시오.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



