CacheBy
Merck Anti-MAGEB2
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-MAGEB2

상품 한눈에 보기

Merck Sigma의 Anti-MAGEB2는 rabbit 소스의 polyclonal primary antibody로, 인간 MAGEB2 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, immunohistochemistry에 적합하고 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-MAGEB2

Anti-MAGEB2

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies의 affinity isolated polyclonal antibody로, 인간 MAGEB2 단백질을 인식합니다.

생물학적 정보

Recombinant protein corresponding to MAGE family member B2

Sequence:
EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP

스펙 정보

항목 내용
Biological Source Rabbit
Conjugation Unconjugated
Antibody Form Affinity isolated antibody
Product Type Primary antibodies
Clone Type Polyclonal
Product Line Prestige Antibodies® Powered by Atlas Antibodies
Formulation Buffered aqueous glycerol solution
Species Reactivity Human
Packaging Antibody small pack of 25 μL
Enhanced Validation Orthogonal RNAseq, Independent
Application Technique(s) Immunohistochemistry (1:1000–1:2500)
UniProt Accession O15479
Gene Information Human MAGEB2 (4113)
Shipping Condition Wet ice
Storage Temperature −20°C

향상된 검증

이 항체는 orthogonal RNAseq 및 independent validation을 통해 검증되었습니다.
자세한 내용은 Antibody Enhanced Validation을 참고하십시오.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.