CacheBy
Merck Anti-MAST1
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-MAST1

상품 한눈에 보기

Merck Anti-MAST1은 토끼 유래 polyclonal 1차 항체로, 인간 MAST1 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, immunohistochemistry(1:50–1:200)에 적합합니다. Buffered glycerol 용액 형태로 제공되며 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-MAST1

Anti-MAST1

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody로 제작된 Merck Anti-MAST1은 인간 MAST1 단백질을 인식하는 토끼 유래 polyclonal 항체입니다.

생물학적 정보

항목 내용
Biological Source Rabbit
Conjugation Unconjugated
Antibody Form Affinity isolated antibody
Antibody Type Primary antibody
Clone Polyclonal
Product Line Prestige Antibodies® Powered by Atlas Antibodies
Form Buffered aqueous glycerol solution
Species Reactivity Human
Packaging Small pack of 25 μL
Enhanced Validation Orthogonal RNAseq
Technique(s) Immunohistochemistry: 1:50–1:200
UniProt Accession Q9Y2H9
Shipping Condition Wet ice
Storage Temperature −20°C

Gene Information

Human gene: MAST1 (22983)
Recombinant protein corresponding to microtubule associated serine/threonine kinase 1.

Sequence
LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE

참고 링크

자세한 정보는 Antibody Enhanced Validation 페이지를 참조하십시오.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.