
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-DOK2
상품 한눈에 보기
Rabbit polyclonal primary antibody against human DOK2. Affinity isolated and validated by orthogonal RNAseq. Suitable for immunohistochemistry (IHC) applications. Supplied in buffered aqueous glycerol solution, stored at −20°C.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-DOK2
Anti-DOK2
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody
제품 개요
Recombinant protein corresponding to docking protein 2을 인식하는 rabbit polyclonal primary antibody입니다. Affinity isolation 방식으로 정제되었으며, orthogonal RNAseq를 통한 향상된 검증이 완료되었습니다.
주요 특징
- 생물학적 소스: Rabbit
- 항체 형태: Affinity isolated antibody
- 항체 유형: Primary antibody
- 클론: Polyclonal
- 제품 라인: Prestige Antibodies® Powered by Atlas Antibodies
- 결합 상태: Unconjugated
- 형태: Buffered aqueous glycerol solution
- 반응 종: Human
- 검증 방법: Orthogonal RNAseq (Antibody Enhanced Validation)
- 적용 기술: Immunohistochemistry (1:1000–1:2500)
스펙 정보
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibodies |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Small pack of 25 μL |
| Validation | Orthogonal RNAseq |
| Technique(s) | Immunohistochemistry: 1:1000–1:2500 |
| UniProt accession no. | O60496 |
| Shipping conditions | Wet ice |
| Storage temperature | −20°C |
유전자 정보
Gene: DOK2 (9046)
Protein: Docking protein 2
Sequence:
RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



