Merck Anti-CARMIL1 antibody produced in rabbit
토끼에서 생산된 Anti-CARMIL1 항체로, 인간 시료에 반응하는 polyclonal primary antibody입니다. Prestige Antibodies® 라인 제품으로, 면역형광 및 면역조직화학 분석에 적합합니다. −20°C에서 보관하며, 정제된 glycerol 용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-CARMIL1 antibody produced in rabbit
Anti-CARMIL1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, ab1
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장 단위
small pack of 25 μL
향상된 검증
- orthogonal RNAseq
- independent
Learn more about Antibody Enhanced Validation
적용 기술
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:1000–1:2500
면역원 서열
HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
Gene: LRRC16A (55604)
Species: human
LRRC16A (leucine-rich repeat-containing 16A) codes for a capping protein ARP2/3 and myosin-I linker (CARMIL). CARMIL is a large protein expressed at high levels in kidney and other epithelial tissues.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Type | Primary, Polyclonal |
| Product Line | Prestige Antibodies® |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Package Size | 25 μL |
| Validation | Orthogonal RNAseq, Independent |
| Techniques | IF (0.25–2 μg/mL), IHC (1:1000–1:2500) |
| Storage Temperature | −20°C |
| Shipping Condition | Wet ice |
제품 이미지
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.