
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-DOK3
상품 한눈에 보기
Rabbit polyclonal primary antibody against human DOK3 protein. Affinity isolated and unconjugated form in buffered glycerol solution. Validated for immunohistochemistry and western blot applications. Supplied as 25 μL pack, stored at −20 °C.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-DOK3
Anti-DOK3
Prestige Antibodies® Powered by Atlas Antibodies — Affinity isolated antibody
생물학적 소스
- Rabbit
결합
- Unconjugated
항체 형태
- Affinity isolated antibody
항체 유형
- Primary antibody (Polyclonal)
제품 라인
- Prestige Antibodies® Powered by Atlas Antibodies
제형
- Buffered aqueous glycerol solution
반응 종
- Human
포장
- 25 μL small pack
향상된 검증
- Orthogonal RNAseq
자세히 보기: Antibody Enhanced Validation
적용 기술
| Technique | Dilution / Concentration |
|---|---|
| Immunohistochemistry | 1:1000–1:2500 |
| Western blot | 0.04–0.4 μg/mL |
UniProt 수납 번호
배송 상태
- Wet ice
저장 온도
- −20 °C
Gene Information
- Human DOK3 (79930)
Recombinant protein corresponding to docking protein 3
Sequence
SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



