
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-MRPL37 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-MRPL37 항체로, 인간 MRPL37 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인으로 독립적 검증을 거쳤으며, Western blot과 IHC에 적합합니다. −20°C에서 보관하며 25 μL 소포장으로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-MRPL37 antibody produced in rabbit
Anti-MRPL37 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Independent, Orthogonal RNAseq, RNAi knockdown |
| 적용 기술 | Immunoblotting (0.04–0.4 μg/mL), Immunohistochemistry (1:20–1:50) |
| 면역원 서열 | SATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDVK |
| UniProt 수납 번호 | Q9BZE1 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
Gene Information
Human MRPL37 (51253)
The gene MRPL37 (mitochondrial ribosomal protein L37) is mapped to human chromosome 1p32.3.
It encodes a mitochondrial ribosomal protein of the large subunit.
The MRPL37 protein associates with MTO1 (mitochondrial translation optimization factor 1), a regulator of mitochondrial translation.
참고
자세한 내용은 Antibody Enhanced Validation 페이지를 참고하십시오.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



