Merck Anti-SERPINB1 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-SERPINB1 항체로, 인간 SERPINB1 단백질을 검출하는 고품질 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, immunoblotting 및 immunohistochemistry에 적합하며 −20°C에서 보관합니다.

브랜드: Merck Sigma
카테고리: Polyclonal Antibodies

#Merck #Sigma #Merck Sigma

Merck Sigma · Merck Anti-SERPINB1 antibody produced in rabbit

Anti-SERPINB1 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

생물학적 정보

Source: Rabbit
Clone: Polyclonal
Antibody Type: Primary antibody
Conjugation: Unconjugated
Form: Buffered aqueous glycerol solution
Species Reactivity: Human
Product Line: Prestige Antibodies® Powered by Atlas Antibodies

스펙 정보

항목	내용
Quality Level	100
Packaging	Antibody small pack of 25 μL
Validation	Orthogonal RNAseq, Independent
Techniques	Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:2500–1:5000
Immunogen Sequence	GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFK
UniProt Accession	P30740
Shipping Condition	Wet ice
Storage Temperature	−20°C

유전자 정보

Gene: SERPINB1 (1992)
Description: The gene SERPINB1 (leukocyte elastase inhibitor) is mapped to human chromosome 6p25. It belongs to the SERPIN superfamily and SERPINB family. SERPINB1 is present in all bone marrow leukocytes.

Merck Sigma 상품 둘러보기

전체보기

Merck SigmaMerck Anti-MFAP2 antibody produced in rabbit가격 문의VAT별도

Merck SigmaMerck Anti-CST7 antibody produced in rabbit가격 문의VAT별도

Merck SigmaMerck Anti-UQCRC2 antibody produced in rabbit가격 문의VAT별도

Merck SigmaMerck Anti-PINK1 (N-terminal region) antibody produced in rabbit666,500원VAT별도

문의

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.