AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-DPEP1 antibody produced in rabbit
상품 한눈에 보기
Rabbit polyclonal anti-DPEP1 antibody for human detection. Affinity isolated, unconjugated, buffered aqueous glycerol solution. Suitable for immunohistochemistry and western blot. Enhanced validation with RNAseq and recombinant expression.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-DPEP1 antibody produced in rabbit
Anti-DPEP1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody in buffered aqueous glycerol solution.
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL small pack |
| 향상된 검증 | Orthogonal RNAseq, Independent, Recombinant expression |
| Technique(s) | Immunohistochemistry: 1:1000–1:2500 Western blot: 0.04–0.4 μg/mL |
| 면역원 서열 | VMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFQAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGAS |
| UniProt 수납 번호 | P16444 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human DPEP1(1800) |
Gene Description
DPEP1 (dipeptidase 1) is a zinc-dependent metalloproteinase. It is a microsomal, membrane and renal dipeptidase. DPEP1 is a glycosyl-phosphotidylinositol anchored membrane protein and its C-terminal contains a highly hydrophobic sequence.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.