Merck Anti-CD247 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-CD247 폴리클로날 항체로, 인간 CD247 단백질을 표적합니다. Prestige Antibodies® 제품군으로 고품질 검증 완료. 면역블롯 및 면역조직화학에 적합하며, −20°C에서 보관. 비결합형, glycerol 완충 용액 형태.

브랜드: Merck Sigma
카테고리: Polyclonal Antibodies

#Merck #Sigma #Merck Sigma

Merck Sigma · Merck Anti-CD247 antibody produced in rabbit

Anti-CD247 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.

CD247 (cluster of differentiation 247), also known as T-cell receptor T3 zeta chain (CD3ξ), forms part of the TCR-CD3 complex. This gene is localized to human chromosome 1q22-q23 and consists of eight exons. It is one of the four invariant subunits of the TCR-CD3 complex.

제품 사양

항목	내용
생물학적 소스	Rabbit
Quality Level	100
결합	Unconjugated
항체 형태	Affinity isolated antibody
항체 유형	Primary antibody
클론	Polyclonal
제품 라인	Prestige Antibodies® Powered by Atlas Antibodies
형태	Buffered aqueous glycerol solution
반응 종	Human
포장	25 μL (small pack)
향상된 검증	Orthogonal RNAseq
기술(technique)	Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:50–1:200
면역원 서열	KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP
UniProt 수납 번호	P20963
배송 상태	Wet ice
저장 온도	−20°C
Gene Information	Human CD247(919)