AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-CNN1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-CNN1 항체로, 인간·쥐·생쥐 시료에 반응합니다. Prestige Antibodies® 라인 제품으로, 정제된 glycerol 완충 용액 형태입니다. 면역블롯 및 면역조직화학에 적합하며, CNN1 단백질 검출에 사용됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-CNN1 antibody produced in rabbit
Anti-CNN1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human, Rat, Mouse |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Orthogonal RNAseq (Antibody Enhanced Validation) |
| 적용 기술 | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS |
| UniProt 수납 번호 | P51911 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human CNN1(1264) |
Gene Description
The CNN1 (calponin 1) gene encodes a 34 kDa protein with sequence similarity to cardiac troponin I and T. It is mainly localized in the cytoskeleton and contractile apparatus of differentiated smooth muscle cells.
Calponin has three isoforms—calponin-1 (basic), calponin-2 (neutral), and calponin-3 (acidic)—which share a conserved amino-terminal region containing a calponin homology (CH)3 domain and a troponin I-like/actin-binding domain.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.