CacheBy
Merck Anti-COL12A1 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-COL12A1 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-COL12A1 항체로 인간 COL12A1 단백질 검출에 적합. Prestige Antibodies® 라인 제품으로 고품질 polyclonal 항체. 면역블롯 및 면역조직화학에 사용 가능하며 −20°C에서 보관. buffered glycerol 용액 형태로 제공.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:39
Merck HPA009143-100UL Anti-COL12A1 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
840,700원VAT 포함 924,770원

Merck Sigma · Merck Anti-COL12A1 antibody produced in rabbit

Anti-COL12A1 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

생물학적 소스

rabbit

제품 사양

항목 내용
Quality Level 100
결합 unconjugated
항체 형태 affinity isolated antibody
항체 유형 primary antibodies
클론 polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 buffered aqueous glycerol solution
반응 종 human
포장 antibody small pack of 25 μL
향상된 검증 orthogonal RNAseq
기술(technique) immunoblotting: 0.04–0.4 μg/mL
immunohistochemistry: 1:50–1:200
면역원 서열 VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
UniProt 수납 번호 Q99715
배송 상태 wet ice
저장 온도 −20°C

Gene Information

human ... COL12A1(1303)

COL12A1 (collagen type XII α1) gene is localized to human chromosome 6q13.
It encodes the α chain of type XII collagen, which belongs to the fibril-associated collagens with interrupted triple helices (FACIT) family.
Collagen type XII consists of two short collagenous triple-helical domains and three non-triple-helical domains.

제품 이미지

(이미지 없음)

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.