CacheBy
Merck Anti-KRT7 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-KRT7 antibody produced in rabbit

상품 한눈에 보기

Rabbit에서 생산된 Anti-KRT7 폴리클로날 항체로, Prestige Antibodies® 라인 제품입니다. 인간, 생쥐, 랫트에 반응하며, 면역블롯팅과 면역조직화학에 적합합니다. −20°C에서 보관하며, 고품질 정제된 glycerol 용액 형태입니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-KRT7 antibody produced in rabbit

Anti-KRT7 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies 제품으로, rabbit에서 생산된 affinity isolated primary antibody입니다. Buffered aqueous glycerol solution 형태로 제공되며, 인간, 생쥐, 랫트에 반응합니다.

제품 스펙

항목 내용
생물학적 소스 Rabbit
품질 등급 100
결합 형태 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
반응 종 Rat, Mouse, Human
포장 25 μL (small pack)
향상된 검증 Orthogonal RNAseq
적용 기술 Immunoblotting: 0.04–0.4 μg/mL
Immunohistochemistry: 1:500–1:1000
면역원 서열 RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD
UniProt 번호 P08729
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Human KRT7 (Keratin, type II cytoskeletal 7) gene encodes a type II cytokeratin with a molar mass of 55 kDa.
It is expressed during the differentiation of simple and stratified epithelial tissues and is also found in the epithelia lining the cavities of internal organs such as the stomach.

추가 정보

Learn more about Antibody Enhanced Validation

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.