
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-CD69 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-CD69 항체로, 인간 CD69 단백질을 특이적으로 인식하는 polyclonal 1차 항체입니다. Atlas Antibodies의 Prestige Antibodies® 라인 제품으로, 면역조직화학(IHC)에 적합하며 정제된 glycerol 완충 용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-CD69 antibody produced in rabbit
Anti-CD69 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
Cluster of differentiation 69 (CD69)는 인간 염색체 12p13.31에 위치한 유전자로부터 발현되는 type II integral membrane 단백질입니다. CD69는 C-type lectin 계열의 표면 수용체로, 적혈구를 제외한 모든 골수 유래 세포에서 발현됩니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugation | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibodies |
| Clonality | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Small pack of 25 μL |
| Enhanced validation | Orthogonal RNAseq |
| Technique(s) | Immunohistochemistry (IHC): 1:50–1:200 |
| Immunogen sequence | VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
| UniProt accession no. | Q07108 |
| Shipping condition | Wet ice |
| Storage temperature | −20°C |
| Gene information | Human CD69 (969) |
참고 정보
- Learn more about Antibody Enhanced Validation
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



