CacheBy
Merck Anti-AQP1 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-AQP1 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-AQP1 항체로 인간 AQP1 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품이며, 면역형광·면역조직화학·웨스턴블롯 등에 적합합니다. 친화 정제된 폴리클로날 항체로 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-AQP1 antibody produced in rabbit

Anti-AQP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution.


제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human
포장 Small pack of 25 μL
향상된 검증 Recombinant expression, orthogonal RNAseq
Technique(s) Immunoblotting: 0.04–0.4 μg/mL
Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:1000–1:2500
면역원 서열 PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
UniProt 수납 번호 P29972
배송 상태 Wet ice
저장 온도 −20 °C
Gene Information Human AQP1(358)

Gene Information

The gene AQP1 (aquaporin-1) is mapped to human chromosome 7p14.
It is an integral membrane protein.


참고 링크

Learn more about Antibody Enhanced Validation

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.