Merck Anti-EPCAM antibody produced in rabbit
토끼에서 생산된 Anti-EPCAM polyclonal antibody로 인간 EpCAM 단백질 검출에 적합. Prestige Antibodies® Powered by Atlas Antibodies 제품군. Affinity isolated, buffered glycerol 용액 형태. IHC 및 Western blot 등 다양한 응용 가능.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-EPCAM antibody produced in rabbit
Anti-EPCAM antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
Epithelial cell adhesion molecule (EpCAM) 검출용 토끼 유래 polyclonal antibody입니다. 인간 EpCAM 단백질에 특이적으로 반응하며, 면역조직화학(IHC) 및 면역블롯(WB) 등의 다양한 연구에 활용할 수 있습니다.
제품 스펙
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL (small pack) |
| 검증 방식 | Orthogonal RNAseq, Recombinant expression |
| 적용 기술 | Immunoblotting (0.04–0.4 μg/mL), Immunohistochemistry (1:200–1:500) |
| 면역원 서열 | LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY |
| UniProt 번호 | P16422 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human EPCAM (4072) |
유전자 정보
Epithelial cell adhesion molecule (EpCAM) gene, also referred to as TACSTD (tumor-associated calcium signal transducer) 1, is mapped to human chromosome 2p21, a region composed of the mutS homolog 2 (MSH2) and mutS homolog 6 (MSH6) DNA mismatch repair genes.
The gene codes for a membrane-associated glycoprotein expressed in epithelial cells of different organs.
추가 정보
자세한 내용은 Antibody Enhanced Validation 페이지에서 확인할 수 있습니다.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.