원본
Thermo Fisher Scientific LRIG3 Polyclonal Antibody
상품 한눈에 보기
LRIG3 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal 항체로, Western blot에 적합합니다. 인간 및 랫트 반응성, 비결합형 상태이며 항원 친화 크로마토그래피로 정제되었습니다. 배아 발달 및 내이 형성 연구용으로 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 10:00
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579611 LRIG3 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific LRIG3 Polyclonal Antibody
Thermo Fisher Scientific LRIG3 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.1–0.5 µg/mL
Publications: -
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428–465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746726 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
LRIG3는 배아 발달 중 두개안면 및 내이 형성에 관여할 수 있으며, 내이의 외측 반고리관 형성을 조절하는 역할을 할 가능성이 있습니다. 이는 NTN1의 발현을 제한함으로써 기능할 수 있습니다.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Lamin B2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MALT1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific LUM Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific LOXL1 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.