CacheBy
Atlas Antibodies Anti-TGS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TGS1 Antibody

상품 한눈에 보기

Human TGS1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 실험에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, glycerol/PBS buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA029824-100 Anti-TGS1 Antibody, trimethylguanosine synthase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029824-25 Anti-TGS1 Antibody, trimethylguanosine synthase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TGS1 Antibody

Anti-TGS1 Antibody

Target: Trimethylguanosine synthase 1 (TGS1)
Type: Polyclonal Antibody against Human TGS1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against human TGS1, also known as trimethylguanosine synthase 1.


Alternative Gene Names

  • NCOA6IP
  • PIMT

Open Datasheet


Target Information

항목 내용
Target Protein Trimethylguanosine synthase 1
Target Gene TGS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAE
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.