Atlas Antibodies Anti-TGM1 Antibody

상품 한눈에 보기

인체 TGM1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 적용에 적합합니다. Rabbit 호스트에서 생산되었으며 PrEST 항원으로 특이적 정제되었습니다. Human 반응성이 검증되었고 RNA-seq 데이터 기반 Orthogonal validation을 제공합니다.

카탈로그번호: HPA040171-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040171-100 Anti-TGM1 Antibody, transglutaminase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040171-25 Anti-TGM1 Antibody, transglutaminase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TGM1 Antibody

Anti-TGM1 Antibody

Target Protein: transglutaminase 1
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry) – Orthogonal validation using comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Product Description

Polyclonal Antibody against Human TGM1

Alternative Gene Names

ICR2, LI, LI1, TGASE, TGK

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	transglutaminase 1
Target Gene	TGM1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000020136 (74%), Mouse ENSMUSG00000022218 (74%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand