Atlas Antibodies Anti-TFAM Antibody

상품 한눈에 보기

Human TFAM 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. Orthogonal validation을 통해 단백질 발현 검증이 이루어졌으며, Rabbit에서 생산된 IgG 항체입니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA040648-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040648-100 Anti-TFAM Antibody, transcription factor A, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040648-25 Anti-TFAM Antibody, transcription factor A, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TFAM Antibody

Anti-TFAM Antibody

Target: Transcription factor A, mitochondrial (TFAM)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human TFAM.

Alternative Gene Names

TCF6, TCF6L2

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	Transcription factor A, mitochondrial
Target Gene	TFAM
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	AELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKK
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000000613 (62%), Mouse ENSMUSG00000003923 (60%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.