CacheBy
Atlas Antibodies Anti-TFAM Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TFAM Antibody

상품 한눈에 보기

Human TFAM 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. Orthogonal validation을 통해 단백질 발현 검증이 이루어졌으며, Rabbit에서 생산된 IgG 항체입니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040648-100 Anti-TFAM Antibody, transcription factor A, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040648-25 Anti-TFAM Antibody, transcription factor A, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TFAM Antibody

Anti-TFAM Antibody

Target: Transcription factor A, mitochondrial (TFAM)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human TFAM.


Alternative Gene Names

TCF6, TCF6L2

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein Transcription factor A, mitochondrial
Target Gene TFAM
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKK
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000000613 (62%), Mouse ENSMUSG00000003923 (60%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.