CacheBy
Atlas Antibodies Anti-TEX264 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TEX264 Antibody

상품 한눈에 보기

Human TEX264 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화정제되었습니다. 인간에 대해 검증되었으며, RNA-seq 데이터 기반 직교 검증을 거쳤습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA017739-100 Anti-TEX264 Antibody, testis expressed 264 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017739-25 Anti-TEX264 Antibody, testis expressed 264 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TEX264 Antibody

Anti-TEX264 Antibody

Target: testis expressed 264 (TEX264)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low target expression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human TEX264.


Alternative Gene Names

FLJ13935, ZSIG11

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein testis expressed 264
Target Gene TEX264
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE

Species Reactivity

항목 내용
Verified Species Human
Mouse Ortholog ENSMUSG00000040813 (75%)
Rat Ortholog ENSRNOG00000013201 (72%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.