CacheBy
Atlas Antibodies Anti-TEX15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TEX15 Antibody

상품 한눈에 보기

Human TEX15 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증되었고, 생식세포 관련 연구에 적합. PBS와 글리세롤 기반 보존용액 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036800-100 Anti-TEX15 Antibody, testis expressed 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036800-25 Anti-TEX15 Antibody, testis expressed 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TEX15 Antibody

Anti-TEX15 Antibody

Target Protein: Testis expressed 15 (TEX15)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TEX15.


Alternative Gene Names

  • CT42

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
STQNNETELTSPILLPDLQIKITNIFRPGFSPTADSLALKDSFCTHVTEATKPEINKEDGEILGFDIYSQPFGENADYPCEDKVDNIRQESGPVSNSEISLSFDLSR


Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000009628 (50%)
  • Rat ENSRNOG00000007748 (48%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.