Atlas Antibodies Anti-TEX15 Antibody

상품 한눈에 보기

Human TEX15 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증되었고, 생식세포 관련 연구에 적합. PBS와 글리세롤 기반 보존용액 포함.

카탈로그번호: HPA036800-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036800-100 Anti-TEX15 Antibody, testis expressed 15 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036800-25 Anti-TEX15 Antibody, testis expressed 15 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TEX15 Antibody

Anti-TEX15 Antibody

Target Protein: Testis expressed 15 (TEX15)
Supplier: Atlas Antibodies

Recommended Applications

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TEX15.

Alternative Gene Names

CT42

Open Datasheet (PDF)

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
STQNNETELTSPILLPDLQIKITNIFRPGFSPTADSLALKDSFCTHVTEATKPEINKEDGEILGFDIYSQPFGENADYPCEDKVDNIRQESGPVSNSEISLSFDLSR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000009628 (50%)
Rat ENSRNOG00000007748 (48%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.