Atlas Antibodies Anti-TEX101 Antibody

상품 한눈에 보기

Human TEX101 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. 정소 특이적 단백질 발현 검증에 유용하며, PrEST 항원으로 친화 정제되었습니다. Rabbit 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042513-100 Anti-TEX101 Antibody, testis expressed 101 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042513-25 Anti-TEX101 Antibody, testis expressed 101 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Testis expressed 101 (TEX101)
Supplier: Atlas Antibodies

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Western Blot (WB)

Polyclonal antibody against human TEX101.

CT131, MGC4766, SGRG, SPATA44

항목	내용
Target Protein	Testis expressed 101
Target Gene	TEX101
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000062773 (49%), Rat ENSRNOG00000020057 (49%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.