AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TES Antibody
상품 한눈에 보기
인간 TES 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB 및 ICC 응용에 적합합니다. Rabbit 호스트에서 생산되었으며 PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되었고, RNA-seq 및 독립 항체 비교로 검증된 신뢰성 높은 제품입니다.
- 카탈로그번호
- HPA018123-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018123-100 Anti-TES Antibody, testis derived transcript (3 LIM domains) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018123-25 Anti-TES Antibody, testis derived transcript (3 LIM domains) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TES Antibody
Anti-TES Antibody
Target: testis derived transcript (3 LIM domains)
Recommended Applications
- IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Orthogonal validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Immunocytochemistry application validated.
Product Description
Polyclonal Antibody against Human TES
Alternative Gene Names
DKFZP586B2022, TESS-2, TESTIN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | testis derived transcript (3 LIM domains) |
| Target Gene | TES |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000051952 (85%), Mouse ENSMUSG00000029552 (82%) |
Antigen Sequence:
QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVD
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.