Atlas Antibodies Anti-TECPR2 Antibody

상품 한눈에 보기

인간 TECPR2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품입니다. Rabbit 유래 IgG 항체로 PrEST 항원 친화 정제 방식으로 제조되었습니다.

카탈로그번호: HPA000658-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA000658-100 Anti-TECPR2 Antibody, tectonin beta-propeller repeat containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA000658-25 Anti-TECPR2 Antibody, tectonin beta-propeller repeat containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TECPR2 Antibody

Anti-TECPR2 Antibody

tectonin beta-propeller repeat containing 2

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Suitable for Immunohistochemistry (IHC) and Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human TECPR2

Alternative Gene Names

KIAA0329

Open Datasheet

Target Information

항목	내용
Target Protein	tectonin beta-propeller repeat containing 2
Target Gene	TECPR2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000021275 (89%), Rat ENSRNOG00000021904 (89%)

Antigen Sequence

VSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALSTRTVWARCPNGDLARRYGVTDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPGYLLQRLTKTFSHSHGTQKSSQAAMPHPEDLEDEWEVI

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand