Atlas Antibodies Anti-TEAD1 Antibody

상품 한눈에 보기

인간 TEAD1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 유래하였으며 WB 및 ICC에 적합합니다. PrEST 항원으로 정제되었으며 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 sodium azide가 포함되어 있습니다.

카탈로그번호: HPA062471-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062471-100 Anti-TEAD1 Antibody, TEA domain family member 1 (SV40 transcriptional enhancer factor) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062471-25 Anti-TEAD1 Antibody, TEA domain family member 1 (SV40 transcriptional enhancer factor) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TEAD1 Antibody

Anti-TEAD1 Antibody

Target Information

Target Protein: TEA domain family member 1 (SV40 transcriptional enhancer factor)
Target Gene: TEAD1
Alternative Gene Names: AA, TCF13, TEF-1

Recommended Applications

Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TEAD1.

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
```
Verified Species Reactivity: Human
Interspecies Information:
- Rat ENSRNOG00000015488 (99%)
- Mouse ENSMUSG00000055320 (97%)

Antibody Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet