CacheBy
Atlas Antibodies Anti-TDP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TDP2 Antibody

상품 한눈에 보기

Human TDP2 단백질을 인식하는 토끼 폴리클로날 항체로, PrEST 항원을 이용해 친화 정제됨. 면역세포화학 등 다양한 연구 응용에 적합하며, 높은 특이성과 재현성을 제공. 보존용으로 글리세롤과 PBS 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA074011-100 Anti-TDP2 Antibody, tyrosyl-DNA phosphodiesterase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074011-25 Anti-TDP2 Antibody, tyrosyl-DNA phosphodiesterase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TDP2 Antibody

Anti-TDP2 Antibody

Target: tyrosyl-DNA phosphodiesterase 2 (TDP2)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human TDP2, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • TTRAP

Target Information

항목 내용
Target Protein tyrosyl-DNA phosphodiesterase 2
Target Gene TDP2
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000035958 (77%), Rat ENSRNOG00000018246 (76%)

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.