Atlas Antibodies Anti-TCP1 Antibody

상품 한눈에 보기

Human TCP1 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. IHC 및 WB 분석에 적합하며, 독립 항체 검증으로 높은 신뢰성 확보. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027337-100 Anti-TCP1 Antibody, t-complex 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027337-25 Anti-TCP1 Antibody, t-complex 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: t-complex 1
Supplier: Atlas Antibodies

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against Human TCP1.

CCT1, Ccta, D6S230E

항목	내용
Target Protein	t-complex 1
Target Gene	TCP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	CVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERK
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000014160 (100%), Mouse ENSMUSG00000068039 (99%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.