CacheBy
Atlas Antibodies Anti-TCIRG1 Antibody
원본

Atlas Antibodies Anti-TCIRG1 Antibody

상품 한눈에 보기

인간 TCIRG1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원을 이용해 친화 정제되었습니다. 세포 내 리소좀 V0 소단위 A3 연구에 유용합니다.

카탈로그번호
HPA038742-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038742-100 Anti-TCIRG1 Antibody, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038742-25 Anti-TCIRG1 Antibody, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCIRG1 Antibody

Anti-TCIRG1 Antibody

T-cell, immune regulator 1, ATPase, H⁺ transporting, lysosomal V0 subunit A3


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TCIRG1.


Alternative Gene Names

a3, Atp6i, ATP6N1C, ATP6V0A3, OC-116, OC116, TIRC7

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein T-cell, immune regulator 1, ATPase, H⁺ transporting, lysosomal V0 subunit A3
Target Gene TCIRG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000017220 (62%), Mouse ENSMUSG00000001750 (62%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.