CacheBy
Atlas Antibodies Anti-TBCK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBCK Antibody

상품 한눈에 보기

Human TBCK 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. 40% glycerol 기반 buffer로 안정적 보관이 가능합니다. 다양한 종 간 교차 반응성 정보 포함.

카탈로그번호
HPA039951-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039951-100 Anti-TBCK Antibody, TBC1 domain containing kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039951-25 Anti-TBCK Antibody, TBC1 domain containing kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBCK Antibody

Anti-TBCK Antibody

Target: TBC1 domain containing kinase (TBCK)
Type: Polyclonal Antibody against Human TBCK


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Rabbit Polyclonal Antibody targeting the human TBCK protein. Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

HSPC302, MGC16169

Open Datasheet (PDF)


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHFKTPS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000028030 93%
Rat ENSRNOG00000011454 91%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.