Atlas Antibodies Anti-TBCA Antibody

상품 한눈에 보기

인간 TBCA 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질 발현 검증 완료. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인체 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036487-100 Anti-TBCA Antibody, tubulin folding cofactor A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036487-25 Anti-TBCA Antibody, tubulin folding cofactor A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Tubulin folding cofactor A
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Western Blot (WB) – Recombinant expression validation using target protein overexpression
Immunocytochemistry (ICC)

Polyclonal antibody against human TBCA.

Target Gene: TBCA
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
MRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEY
```

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000042043	91%
Rat	ENSRNOG00000048342	89%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand