CacheBy
Atlas Antibodies Anti-TBC1D25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBC1D25 Antibody

상품 한눈에 보기

인간 TBC1D25 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 연구용에 적합. Rabbit에서 생산된 IgG형 항체이며, 고순도 친화 정제 방식으로 제조됨. 인간에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029197-100 Anti-TBC1D25 Antibody, TBC1 domain family, member 25 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029197-25 Anti-TBC1D25 Antibody, TBC1 domain family, member 25 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBC1D25 Antibody

Anti-TBC1D25 Antibody

Target Information

  • Protein: TBC1 domain family, member 25
  • Gene: TBC1D25
  • Alternative Gene Name: OATL1

Product Description

Polyclonal antibody against human TBC1D25.

면역조직화학 (IHC)

Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    AVDPQITSLDVLQHILIRAFDLSGKKNFGISYLGRDRLGQEVYLSLLSDWDLSTAFATASKPYLQLRVDIRPSEDSPLLEDWDIISPKDVSGSDVLLAEKRSSLTTAALPFTQSIL

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000039201 96%
Rat ENSRNOG00000005303 95%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Recommended Applications IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.