Atlas Antibodies Anti-TBC1D24 Antibody

상품 한눈에 보기

Human TBC1D24 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. DFNA65, DFNB86 등 대체 유전자명 사용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044712-100 Anti-TBC1D24 Antibody, TBC1 domain family, member 24 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044712-25 Anti-TBC1D24 Antibody, TBC1 domain family, member 24 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human TBC1D24, produced in rabbit.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RGKVYQRLIRDIPCRTVTPDASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLCLANQFPD

Human

Highest antigen sequence identity to orthologs:

Immunohistochemistry (IHC)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use; determine optimal concentrations and conditions per application