CacheBy
Atlas Antibodies Anti-TBC1D22A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBC1D22A Antibody

상품 한눈에 보기

Human TBC1D22A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 높은 특이성과 신뢰성을 제공합니다. Human에 반응하며, 연구용으로 권장됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001173-100 Anti-TBC1D22A Antibody, TBC1 domain family, member 22A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001173-25 Anti-TBC1D22A Antibody, TBC1 domain family, member 22A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBC1D22A Antibody

Anti-TBC1D22A Antibody

Target Information

  • Protein: TBC1 domain family, member 22A
  • Gene: TBC1D22A
  • Alternative Gene Name: C22orf4

Product Description

Polyclonal antibody against Human TBC1D22A, produced in rabbit. Recommended for use in immunohistochemistry (IHC) and immunocytochemistry (ICC).

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    HPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDVSGVPAEVLCNIEADTYWCMSKLLDGIQDNYTFAQPGIQMKVKMLEELVSRIDEQVHRHLDQHEVRYLQFAFRWMNNLLMREVPLRCTIRLWDTYQSE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000051864 92%
Rat ENSRNOG00000059458 59%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.