Atlas Antibodies Anti-TBC1D19 Antibody

상품 한눈에 보기

Human TBC1D19 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 인체 시료 분석 및 단백질 발현 연구에 활용 가능합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039592-100 Anti-TBC1D19 Antibody, TBC1 domain family, member 19 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039592-25 Anti-TBC1D19 Antibody, TBC1 domain family, member 19 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TBC1D19 Antibody

Anti-TBC1D19 Antibody

Target Information

Target Protein: TBC1 domain family, member 19
Target Gene: TBC1D19
Alternative Gene Names: FLJ11082

Product Description

Polyclonal antibody against Human TBC1D19.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
HLGLIQVPLKVKDIPELKECFVELGLNIGQLGIDDSTQVPPELFENEHVRIGQKVLAEQDSAAAQQYIRQGSPTALRAELWALI

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Mouse (ENSMUSG00000039178): 98%
Rat (ENSRNOG00000003003): 96%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.