
원본
Atlas Antibodies Anti-TAX1BP3 Antibody
상품 한눈에 보기
Human TAX1BP3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Western Blot(WB) 및 Immunocytochemistry(ICC)에 적합. PrEST 항원으로 친화 정제됨. Human에 대해 검증된 반응성을 가지며, TIP-1으로도 알려진 TAX1BP3 유전자 표적.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA046410-100 Anti-TAX1BP3 Antibody, Tax1 (human T-cell leukemia virus type I) binding protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046410-25 Anti-TAX1BP3 Antibody, Tax1 (human T-cell leukemia virus type I) binding protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TAX1BP3 Antibody
Anti-TAX1BP3 Antibody
Tax1 (human T-cell leukemia virus type I) binding protein 3
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human TAX1BP3
Alternative Gene Names
- TIP-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tax1 (human T-cell leukemia virus type I) binding protein 3 |
| Target Gene | TAX1BP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000040158 (100%) Rat ENSRNOG00000019357 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLSNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Safety Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



