CacheBy
Atlas Antibodies Anti-TAMM41 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAMM41 Antibody

상품 한눈에 보기

Human TAMM41 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. WB 및 IHC 응용에 적합하며, PrEST 항원 기반으로 친화 정제됨. Human에 대해 검증된 반응성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036834-100 Anti-TAMM41 Antibody, TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036834-25 Anti-TAMM41 Antibody, TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAMM41 Antibody

Anti-TAMM41 Antibody

TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human TAMM41

Alternative Gene Names

  • C3orf31
  • DKFZp434E0519
  • MGC16471

Open Datasheet

Target Information

항목 내용
Target Protein TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae)
Target Gene TAMM41
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030316 (78%), Rat ENSRNOG00000007874 (76%)

Antigen Sequence:

MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.