CacheBy
Atlas Antibodies Anti-TAGLN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAGLN Antibody

상품 한눈에 보기

Human TAGLN 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었으며, PrEST 항원으로 친화 정제되었습니다. 인체 반응 확인 및 높은 종간 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019467-100 Anti-TAGLN Antibody, transgelin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019467-25 Anti-TAGLN Antibody, transgelin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAGLN Antibody

Anti-TAGLN Antibody

Target Protein: transgelin
Supplier: Atlas Antibodies

  • IHC (Orthogonal validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human TAGLN

Alternative Gene Names

DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10

Open Datasheet

Specifications

항목 내용
Target Protein transgelin
Target Gene TAGLN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000032085 (97%), Rat ENSRNOG00000017628 (96%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.